missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CA8 Partial ORF (NP_004047, 40 a.a. - 139 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

4055.00 SEK - 6150.00 SEK

Specifications

Name CA8 (Human) Recombinant Protein (Q01)
Recombinant Yes
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molecular Weight 36.74kDa
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16115484
View Documents Promotion Details
Abnova™
H00000767-Q01.25UG
25 ug
6150.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 28-07-2022
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16105484
View Documents Promotion Details
Abnova™
H00000767-Q01.10UG
10 ug
4055.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 28-07-2022
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form. [provided by RefSeq]

Sequence: VFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPME
Specifications

Specifications

CA8 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.74kDa
SDS
Product Certifications