missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CACNB1 Partial ORF (NP_000714, 500 a.a. - 598 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000782-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16185514

  • 5030.41 SEK / 25µg

Estimated Shipment: 18-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. [provided by RefSeq]

Sequence: FDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
Specifications

Specifications

NP_000714
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
FDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
RUO
CACNB1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
782
CACNB1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CAB1/CACNLB1/CCHLB1/MGC41896
CACNB1
Yes
Videos
SDS
Documents
Certificates