missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CAGE1 Partial ORF (NP_786887.1, 2 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00285782-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16132767

  • 3343.96 SEK / 10µg

Estimated Shipment: 19-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: NKDYQKFWSSPSDPVHFEVDTSHEKVESMSESDTMNVSNLSQGVMLSHSPICMETTGTTCDLPQNEIKNFERENEYESTLCEDAYGTLDNLLNDNNIEN
Specifications

Specifications

NP_786887.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NKDYQKFWSSPSDPVHFEVDTSHEKVESMSESDTMNVSNLSQGVMLSHSPICMETTGTTCDLPQNEIKNFERENEYESTLCEDAYGTLDNLLNDNNIEN
RUO
CAGE1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
285782
CAGE1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CTAG3/FLJ40441/bA69L16.7
CAGE1
Yes
Videos
SDS
Documents
Certificates