missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CCL1 Partial ORF (NP_002972, 24 a.a. - 96 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006346-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16184995

  • 3343.96 SEK / 10µg

Estimated Shipment: 23-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine receptor CCR8. [provided by RefSeq]

Sequence: KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Specifications

Specifications

NP_002972
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.77kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
RUO
CCL1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6346
CCL1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
I-309/P500/SCYA1/SISe/TCA3
CCL1
Yes
Videos
SDS
Documents
Certificates