missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human CDR2 Full-length ORF (AAH17503, 1 a.a. - 454 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16183081
compliance-icons

Abnova™ Human CDR2 Full-length ORF (AAH17503, 1 a.a. - 454 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16183081
25 ug, 25µg
Click to view available options
Quantity:
10 ug
25 ug
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16183081

Brand: Abnova™ H00001039P01.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Used for AP, Array, ELISA, WB-Re

Sequence: MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS

Specifications

Accession Number AAH17503
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 1039
Molecular Weight (g/mol) 75.68kDa
Name CDR2 (Human) Recombinant Protein (P01)
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 ug
Immunogen MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias CDR62/Yo
Common Name CDR2
Gene Symbol CDR2
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
compliance-icons
Product Identifier
  • CDR2 (Human) Recombinant Protein (P01)
Signal Word
  • Warning
Hazard Category
  • Acute toxicity Category 4
  • Serious eye damage/eye irritation Category 2
  • Skin corrosion/irritation Category 2
Hazard Statement
  • H302-Harmful if swallowed.
  • H315-Causes skin irritation.
  • H319-Causes serious eye irritation.
Precautionary Statement
  • P102-Keep out of reach of children.
  • P103-Read label before use.
  • P233-Keep container tightly closed.
  • P264-Wash hands thoroughly after handling.
  • P270-Do not eat, drink or smoke when using this product.
  • P280-Wear protective gloves/protective clothing/eye protection/face protection.
  • P301+P310-IF SWALLOWED: Immediately call a POISON CENTER/doctor /
  • P303+P361+P353-IF ON SKIN (or hair): Take off immediately all contaminated clothing. Rinse skin with water/ shower.
  • P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
  • P404-Store in a closed container.
  • P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.
Supplemental information
  • MIXTURE LIST-Contains : tris-HCl, reduced glutathione
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human CDR2 Full-length ORF (AAH17503, 1 a.a. - 454 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.