missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human CITED4 Partial ORF (NP_597724.1, 131 a.a. - 184 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16035805

Abnova™ Human CITED4 Partial ORF (NP_597724.1, 131 a.a. - 184 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16035805
10 μg, 10µg
Click to view available options
Quantity:
10 μg
25 μg
missing translation for 'unitSize'
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Product Code. 16035805

Brand: Abnova™ H00163732Q01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
View alternative products

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Used for AP, Array, ELISA, WB-Re

CITED4 belongs to a family of transcriptional coactivators that bind several proteins, including CREB-binding protein (MIM 600140) and p300 (MIM 602700).[supplied by OMIM]

Sequence: GMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC

Spécification

Accession Number NP_597724.1
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 163732
Molecular Weight (g/mol) 31.68kDa
Name CITED4 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Immunogen GMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Common Name CITED4
Gene Symbol CITED4
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit
Abnova™ Human CITED4 Partial ORF (NP_597724.1, 131 a.a. - 184 a.a.) Recombinant Protein with GST-tag at N-terminal >

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis