missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CLDN7 Full-length ORF (NP_001298.2, 1 a.a. - 211 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4125.00 SEK - 6260.00 SEK
Specifications
| Accession Number | NP_001298.2 |
|---|---|
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 1366 |
| Molecular Weight (g/mol) | 48.8kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16146637
|
Abnova™
H00001366-P01.25UG |
25 ug |
6260.00 SEK
25µg |
Estimated Shipment: 06-11-2023 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16136637
|
Abnova™
H00001366-P01.10UG |
10 ug |
4125.00 SEK
10µg |
Estimated Shipment: 06-11-2023 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells (Zheng et al., 2003 [PubMed 14502431]).[supplied by OMIM]
Sequence: MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYVSpecifications
| NP_001298.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 48.8kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV | |
| RUO | |
| CLDN7 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 1366 | |
| CLDN7 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CEPTRL2/CPETRL2/Hs.84359/claudin-1 | |
| CLDN7 | |
| Recombinant | |
| wheat germ expression system |