missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human COX6B2 Full-length ORF (NP_653214.2, 1 a.a. - 88 a.a.) Recombinant Protein with GST-tag at N-terminal

Liquid

Brand:  Abnova™ H00125965-P02.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16107693

  • 4055.00 SEK / 10µg
Estimated Shipment: 12-09-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI
Specifications

Specifications

NP_653214.2
Liquid
125965
COX6B2 (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue
MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI
RUO
COX6B2
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.42kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
COXVIB2/MGC119094
COX6B2
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers