missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human DEAF1 Partial ORF (NP_066288, 466 a.a. - 564 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4630.00 SEK - 7020.00 SEK
Specifications
Accession Number | NP_066288 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 10522 |
Molecular Weight (g/mol) | 36.63kDa |
Description
Sequence: TAQQLKTLFEQAKHASTYREAATNQAKIHADAERKEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHICGQSAAVTVQADEVHVAESVMEKVTSpecifications
NP_066288 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.63kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
NUDR/SPN/ZMYND5 | |
DEAF1 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
10522 | |
DEAF1 (Human) Recombinant Protein (Q01) | |
TAQQLKTLFEQAKHASTYREAATNQAKIHADAERKEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHICGQSAAVTVQADEVHVAESVMEKVT | |
RUO | |
DEAF1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ Human DEAF1 Partial ORF (NP_066288, 466 a.a. - 564 a.a.) Recombinant Protein with GST-tag at N-terminal