missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human DIABLO Partial ORF (AAH11909, 119 a.a. - 218 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
Description
This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and it moderates the caspase inhibition of IAPs. Multiple polyadenylation sites have been found for this gene. Four alternatively spliced transcript variants have been described for this gene, with two of them encoding different isoforms and the other two probably not encoding a protein. [provided by RefSeq]
Sequence: SLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQ
Specifications
Specifications
| Accession Number | AAH11909 |
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 56616 |
| Molecular Weight (g/mol) | 36.63kDa |
| Name | DIABLO (Human) Recombinant Protein (Q01) |
| Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quantity | 25 μg |
| Immunogen | SLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQ |
| Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ Human DIABLO Partial ORF (AAH11909, 119 a.a. - 218 a.a.) Recombinant Protein with GST-tag at N-terminal >
Spot an opportunity for improvement?Share a Content Correction