Learn More
Abnova™ Human EDNRB Partial ORF (AAH14472.1, 27 a.a. - 101 a.a.) Recombinant Protein with GST-tag at N-terminal
Description
The protein encoded by this gene is a G protein-coupled receptor which activates a phosphatidylinositol-calcium second messenger system. Its ligand, endothelin, consists of a family of three potent vasoactive peptides: ET1, ET2, and ET3. Studies suggest that the multigenic disorder, Hirschsprung disease type 2, is due to mutations in the endothelin receptor type B gene. Three transcript variants encoding two different isoforms have been found for this gene. While both isoforms bind ET1, they exhibit different responses upon binding, suggesting that they may be functionally distinct. [provided by RefSeq]
Specifications
Specifications
| Accession Number | AAH14472.1 |
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 1910 |
| Molecular Weight (g/mol) | 33.88kDa |
| Name | EDNRB (Human) Recombinant Protein (Q02) |
| Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue |
| Quantity | 10 ug |
| Immunogen | EERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFK |
| Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Show More |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.