missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human EIF1AY Partial ORF (NP_004672.2, 22 a.a. - 95 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00009086-Q03.25ug
Additional Details : Weight : 0.02000kg
Description
This gene encodes a protein similar to eukaryotic translation initiation factor 1A (EIF1A). EIF1A is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. [provided by RefSeq]
Sequence: EKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYSpecifications
| NP_004672.2 | |
| Liquid | |
| 9086 | |
| EIF1AY (Human) Recombinant Protein (Q03) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| EIF1AY | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.88kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| EKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKY | |
| RUO | |
| EIF1AY | |
| Yes | |
| wheat germ expression system |