missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human EIF2C3 Partial ORF (NP_079128, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00192669-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16132347

  • 3343.96 SEK / 10µg

Estimated Shipment: 03-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a tandem cluster of closely related family members including argonaute 4 and eukaryotic translation initiation factor 2C, 1. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Sequence: MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPRRVNREVVDSMVQHFKVTIFGDRRPVYDGKRSLYTANPLPV
Specifications

Specifications

NP_079128
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MEIGSAGPAGAQPLLMVPRRPGYGTMGKPIKLLANCFQVEIPKIDVYLYEVDIKPDKCPRRVNREVVDSMVQHFKVTIFGDRRPVYDGKRSLYTANPLPV
RUO
EIF2C3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
192669
EIF2C3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AGO3/FLJ12765/MGC86946
EIF2C3
Yes
Videos
SDS
Documents
Certificates