missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human FAM9B Partial ORF (NP_995321.1, 31 a.a. - 86 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00171483-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Sequence: DVTDEHGEREPFAETDEHTGANTKKPEDTAEDLTAKRKRMKMDKTCSKTKNKSKHASpecifications
| NP_995321.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.9kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| DVTDEHGEREPFAETDEHTGANTKKPEDTAEDLTAKRKRMKMDKTCSKTKNKSKHA | |
| RUO | |
| FAM9B | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 171483 | |
| FAM9B (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ40182 | |
| FAM9B | |
| Recombinant | |
| wheat germ expression system |