missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FGF17 Partial ORF (NP_003858, 100 a.a. - 199 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00008822-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16119355

  • 4055.00 SEK / 10µg
Estimated Shipment: 12-07-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was shown to be prominently expressed in the cerebellum and cortex. The mouse homolog of this gene was localized to specific sites in the midline structures of the forebrain, the midbrain-hindbrain junction, developing skeleton and developing arteries, which suggests a role in central nervous system, bone and vascular development. This gene was referred to as FGF-13 in reference 2, however, its amino acid sequence and chromosomal localization are identical to FGF17. [provided by RefSeq]

Sequence: KGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVG
Specifications

Specifications

NP_003858
Liquid
8822
FGF17 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FGF-13
FGF17
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVG
RUO
FGF17
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers