missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FSHR Partial ORF (NP_000136, 18 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002492-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16185151

  • 5030.41 SEK / 25µg

Estimated Shipment: 07-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene belongs to family 1 of G-protein coupled receptors. It is the receptor for follicle stimulating hormone and functions in gonad development. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq]

Sequence: CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP
Specifications

Specifications

NP_000136
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.07kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP
RUO
FSHR
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2492
FSHR (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FSHRO/LGR1/MGC141667/MGC141668/ODG1
FSHR
Yes
Videos
SDS
Documents
Certificates