missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human GAA Partial ORF (AAH40431, 851 a.a. - 952 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16135231

Abnova™ Human GAA Partial ORF (AAH40431, 851 a.a. - 952 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16135231
25 ug, 25µg
Click to view available options
Quantity:
10 ug
25 ug
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16135231

Brand: Abnova™ H00002548Q01.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Used for AP, Array, ELISA, WB-Re

This gene encodes acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Sequence: GEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC

Specifications

Accession Number AAH40431
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 2548
Molecular Weight (g/mol) 36.96kDa
Name GAA (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 ug
Immunogen GEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias LYAG
Common Name GAA
Gene Symbol GAA
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human GAA Partial ORF (AAH40431, 851 a.a. - 952 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.