missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GABRA4 Partial ORF (NP_000800.2, 401 a.a. - 500 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Quantity:
10 ug
25 ug
Unit Size:
10µg
25µg
Description
GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. [provided by RefSeq]
Sequence: GNRTEVGNHSSKSSTVVQESSKGTPRSYLASSPNPFSRANAAETISAARALPSASPTSIRTGYMPRKASVGSASTRHVFGSRLQRIKTTVNTIGATGKLS
Specifications
Specifications
| Accession Number | NP_000800.2 |
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 2557 |
| Molecular Weight (g/mol) | 36.63kDa |
| Name | GABRA4 (Human) Recombinant Protein (Q01) |
| Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue |
| Quantity | 25 ug |
| Immunogen | GNRTEVGNHSSKSSTVVQESSKGTPRSYLASSPNPFSRANAAETISAARALPSASPTSIRTGYMPRKASVGSASTRHVFGSRLQRIKTTVNTIGATGKLS |
| Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ Human GABRA4 Partial ORF (NP_000800.2, 401 a.a. - 500 a.a.) Recombinant Protein with GST-tag at N-terminal >
Spot an opportunity for improvement?Share a Content Correction