missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GABRA4 Partial ORF (NP_000800.2, 401 a.a. - 500 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002557-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138444

  • 5030.41 SEK / 25µg

Estimated Shipment: 08-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. [provided by RefSeq]

Sequence: GNRTEVGNHSSKSSTVVQESSKGTPRSYLASSPNPFSRANAAETISAARALPSASPTSIRTGYMPRKASVGSASTRHVFGSRLQRIKTTVNTIGATGKLS
Specifications

Specifications

NP_000800.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue
GNRTEVGNHSSKSSTVVQESSKGTPRSYLASSPNPFSRANAAETISAARALPSASPTSIRTGYMPRKASVGSASTRHVFGSRLQRIKTTVNTIGATGKLS
RUO
GABRA4
Yes
wheat germ expression system
Liquid
2557
GABRA4 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GABRA4
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates