Learn More
Invitrogen™ Human GALNTL4 (aa 31-101) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP109218
Description
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140132 (PA5-140132. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.
Specifications
Q6P9A2 | |
Blocking Assay, Control | |
374378 | |
100 ÎĽL | |
2900011G21Rik; BC024988; GalNAc-T15; GALNACT18; GalNAc-T18; GalNAc-T-like protein 4; GalNAc-transferase 18; GALNT15; GALNT18; Galntl4; LOW QUALITY PROTEIN: polypeptide N-acetylgalactosaminyltransferase 18; mpp-GalNAc-T18(O18); polypeptide GalNAc transferase 18; Polypeptide GalNAc transferase-like protein 4; polypeptide N-acetylgalactosaminyltransferase 18; polypeptide N-acetylgalactosaminyltransferase-like 4; polypeptide N-acetylgalactosaminyltransferase-like protein 4; pp-GaNTase-like protein 4; protein-UDP acetylgalactosaminyltransferase-like protein 4; putative polypeptide N-acetylgalactosaminyltransferase-like protein 4; RGD1309623; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 4; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 15; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 18; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 4 | |
GALNT18 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human GALNTL4 (aa 31-101) Control Fragment | |
RUO | |
GALNTL4 | |
Unconjugated | |
Recombinant | |
WVTNYIASVYVRGQEPAPDKKLEEDKGDTLKIIERLDHLENVIKQHIQEAPAKPEEAEAEPFTDSSLFAHW | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.