missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GAS2L2 Partial ORF (NP_644814, 665 a.a. - 776 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00246176-Q01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16182537

Estimated Shipment: 02-12-2021

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: LLKVDLEAWKAAPTGSPKPAVTPGPGSLKGKLGARQSGPRTKASLSAKGTHMRKVPPQGGQDCSASTVSASPEAPTPSPLDPNSDKAKACLSKGRRTLRKPKRVPSIYKLKL

Specifications

Accession Number	NP_644814
For Use With (Application)	Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight	38.06kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	LLKVDLEAWKAAPTGSPKPAVTPGPGSLKGKLGARQSGPRTKASLSAKGTHMRKVPPQGGQDCSASTVSASPEAPTPSPLDPNSDKAKACLSKGRRTLRKPKRVPSIYKLKL
Regulatory Status	RUO
Common Name	GAS2L2
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Expression System	wheat germ expression system
Format	Liquid
Gene ID (Entrez)	246176
Name	GAS2L2 (Human) Recombinant Protein (Q01)
Quantity	25 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	GAR17
Gene Symbol	GAS2L2
Recombinant	Yes

Description