Learn More
Abnova™ Human GATA1 Partial ORF (ENSP00000365858, 123 a.a. - 199 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4630.00 SEK - 7020.00 SEK
Specifications
Accession Number | ENSP00000365858 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 2623 |
Molecular Weight (g/mol) | 34.21kDa |
Description
This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia. [provided by RefSeq]
Sequence: DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPCSpecifications
ENSP00000365858 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
34.21kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ERYF1/GF-1/GF1/NFE1 | |
GATA1 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
2623 | |
GATA1 (Human) Recombinant Protein (Q01) | |
DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPC | |
RUO | |
GATA1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.