missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GATA1 Partial ORF (ENSP00000365858, 123 a.a. - 199 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

4515.00 SEK - 6845.00 SEK

Specifications

Accession Number ENSP00000365858
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 2623
Molecular Weight (g/mol) 34.21kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16044045
View Documents Promotion Details
Abnova™
H00002623-Q01.25UG
25 ug
6845.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 27-03-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16034045
View Documents Promotion Details
Abnova™
H00002623-Q01.10UG
10 ug
4515.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 27-03-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia. [provided by RefSeq]

Sequence: DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPC
Specifications

Specifications

ENSP00000365858
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.21kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ERYF1/GF-1/GF1/NFE1
GATA1
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
2623
GATA1 (Human) Recombinant Protein (Q01)
DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPC
RUO
GATA1
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Product Certifications