missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GGTLA1 Partial ORF (NP_004112.1, 510 a.a. - 586 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002687-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16178654

  • 5030.41 SEK / 25µg

Estimated Shipment: 02-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is a member of a gene family that encodes gamma-glutamyl transpeptidase enzymes. This enzyme consists of a heavy and a light chain, and is able to hydrolyze the gamma-glutamyl moiety of glutathione. It converts leukotriene C4 to leukotriene D4, however, it doesn't convert synthetic substrates that are commonly used to assay gamma-glutamyl transpeptidase. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: GFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY
Specifications

Specifications

NP_004112.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.21kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY
RUO
GGT5
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2687
GGTLA1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp566O011/FLJ92733/GGT-REL/GGTLA1
GGT5
Yes
Videos
SDS
Documents
Certificates