missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GPC1 Partial ORF (NP_002072.2, 71 a.a. - 165 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00002817-Q02.10ug
Additional Details : Weight : 0.02000kg
Description
Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. [provided by RefSeq]
Sequence: SEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAESpecifications
| NP_002072.2 | |
| Liquid | |
| 2817 | |
| GPC1 (Human) Recombinant Protein (Q02) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ38078/glypican | |
| GPC1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.08kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| SEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAE | |
| RUO | |
| GPC1 | |
| Wheat Germ (in vitro) | |
| GST |