missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human GPSM1 Full-length ORF (AAH48343.1, 1 a.a. - 166 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16158062

Abnova™ Human GPSM1 Full-length ORF (AAH48343.1, 1 a.a. - 166 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16158062
25 μg, 25µg
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16158062

Brand: Abnova™ H00026086P02.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Used for AP, Array, ELISA, WB-Re

G proteins propagate intracellular signals initiated by G protein-coupled receptors. GPSM1, a receptor-independent activator of G protein signaling, is one of several factors that influence the basal activity of G protein signaling systems (Pizzinat et al., 2001 [PubMed 11278352]).[supplied by OMIM]

Sequence: MDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFFNMLIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGGPEQGAGGPPEPQQQCQPGAS

Specifications

Accession Number AAH48343.1
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 26086
Molecular Weight (g/mol) 44.4kDa
Name GPSM1 (Human) Recombinant Protein (P02)
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 μg
Immunogen MDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFFNMLIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGGPEQGAGGPPEPQQQCQPGAS
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias AGS3/DKFZp727I051
Common Name GPSM1
Gene Symbol GPSM1
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human GPSM1 Full-length ORF (AAH48343.1, 1 a.a. - 166 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.