missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GRB2 Partial ORF (NP_002077, 118 a.a. - 217 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Quantity:
10 ug
25 ug
Unit Size:
10µg
25µg
Description
The protein encoded by this gene binds the epidermal growth factor receptor and contains one SH2 domain and two SH3 domains. Its two SH3 domains direct complex formation with proline-rich regions of other proteins, and its SH2 domain binds tyrosine phosphorylated sequences. This gene is similar to the Sem5 gene of C.elegans, which is involved in the signal transduction pathway. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: YFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
Specifications
Specifications
| Accession Number | NP_002077 |
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 2885 |
| Molecular Weight (g/mol) | 36.74kDa |
| Name | GRB2 (Human) Recombinant Protein (Q01) |
| Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quantity | 25 ug |
| Immunogen | YFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV |
| Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ Human GRB2 Partial ORF (NP_002077, 118 a.a. - 217 a.a.) Recombinant Protein with GST-tag at N-terminal >
Spot an opportunity for improvement?Share a Content Correction