missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GSTZ1 Partial ORF (NP_665877, 109 a.a. - 216 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002954-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16179024

  • 3343.96 SEK / 10µg

Estimated Shipment: 14-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms. [provided by RefSeq]

Sequence: GIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Specifications

Specifications

NP_665877
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.62kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
RUO
GSTZ1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2954
GSTZ1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GSTZ1-1/MAAI/MAI/MGC2029
GSTZ1
Yes
Videos
SDS
Documents
Certificates