missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HES1 Partial ORF (NP_005515.1, 201 a.a. - 280 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

4515.00 SEK - 6845.00 SEK

Specifications

Accession Number NP_005515.1
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 3280
Molecular Weight (g/mol) 34.54kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16034185
View Documents Promotion Details
Abnova™
H00003280-Q03.25UG
25 ug
6845.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 24-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16024185
View Documents Promotion Details
Abnova™
H00003280-Q03.10UG
10 ug
4515.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 24-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq]

Sequence: APCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
Specifications

Specifications

NP_005515.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.54kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ20408/HES-1/HHL/HRY/bHLHb39
HES1
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
3280
HES1 (Human) Recombinant Protein (Q03)
APCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
RUO
HES1
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Product Certifications