missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human HES1 Partial ORF (NP_005515.1, 201 a.a. - 280 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16034185
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human HES1 Partial ORF (NP_005515.1, 201 a.a. - 280 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human HES1 Partial ORF (NP_005515.1, 201 a.a. - 280 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. p-7094645
25 ug, 25µg
Click to view available options
Quantity:
10 ug
25 ug
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16034185

Brand: Abnova™ H00003280Q03.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

This item is not returnable. View return policy

Description

Used for AP, Array, ELISA, WB-Re

This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq]

Sequence: APCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN

Specifications

Accession Number NP_005515.1
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 3280
Molecular Weight (g/mol) 34.54kDa
Name HES1 (Human) Recombinant Protein (Q03)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 ug
Immunogen APCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias FLJ20408/HES-1/HHL/HRY/bHLHb39
Common Name HES1
Gene Symbol HES1
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human HES1 Partial ORF (NP_005515.1, 201 a.a. - 280 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.