missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HIC1 Partial ORF (NP_006488.2, 627 a.a. - 705 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003090-Q02.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16064125

  • 4865.00 SEK / 25µg


Estimated Shipment
12-02-2021
Add to basket

Description

Description

Sequence: PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG
Specifications

Specifications

NP_006488.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.32kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG
RUO
HIC1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3090
HIC1 (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ZBTB29|hic-1
HIC1
Yes
Videos
SDS
Documents