Learn More
Abnova™ Human HOXB6 Partial ORF (NP_724779.1, 1 a.a. - 57 a.a.) Recombinant Protein with GST-tag at N-terminal
Description
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer. [provided by RefSeq]
Specifications
Specifications
Accession Number | NP_724779.1 |
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 3216 |
Molecular Weight (g/mol) | 32.01kDa |
Name | HOXB6 (Human) Recombinant Protein (Q01) |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quantity | 10 ug |
Immunogen | MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSS |
Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Show More |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.