missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HOXB6 Partial ORF (NP_724779.1, 1 a.a. - 57 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00003216-Q01.10ug
Additional Details : Weight : 0.02000kg
Description
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer. [provided by RefSeq]
Sequence: MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSSpecifications
| NP_724779.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.01kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSS | |
| RUO | |
| HOXB6 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 3216 | |
| HOXB6 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| HOX2/HOX2B/HU-2/Hox-2.2 | |
| HOXB6 | |
| Recombinant | |
| wheat germ expression system |