missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human HS3ST1 Full-length ORF (NP_005105.1, 1 a.a. - 307 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16184272

Abnova™ Human HS3ST1 Full-length ORF (NP_005105.1, 1 a.a. - 307 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16184272
10 μg, 10µg
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16184272

Brand: Abnova™ H00009957P01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Used for AP, Array, ELISA, WB-Re

Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein. [provided by RefSeq]

Sequence: MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH

Specifications

Accession Number NP_005105.1
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 9957
Molecular Weight (g/mol) 62.2kDa
Name HS3ST1 (Human) Recombinant Protein (P01)
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Immunogen MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias 3OST/3OST1
Common Name HS3ST1
Gene Symbol HS3ST1
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human HS3ST1 Full-length ORF (NP_005105.1, 1 a.a. - 307 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.