missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HTR7 Partial ORF (AAH47526.1, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003363-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136501

  • 3343.96 SEK / 10µg

Estimated Shipment: 22-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The neurotransmitter, serotonin, is thought to play a role in various cognitive and behavioral functions. The serotonin receptor encoded by this gene belongs to the superfamily of G protein-coupled receptors and the gene is a candidate locus for involvement in autistic disorder and other neuropsychiatric disorders. Three splice variants have been identified which encode proteins that differ in the length of their carboxy terminal ends. [provided by RefSeq]

Sequence: MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTL
Specifications

Specifications

AAH47526.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTL
RUO
HTR7
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3363
HTR7 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
5-HT7
HTR7
Yes
Videos
SDS
Documents
Certificates