Learn More
Invitrogen™ Human IGFBP-1 (aa 91-161) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP98489
Description
Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61388 (PA5-61388. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.
Specifications
P08833 | |
Blocking Assay, Control | |
3484 | |
100 μL | |
AFBP; alpha-pregnancy-associated endometrial globulin; amniotic fluid binding protein; Binding protein 25; Binding protein 26; Binding protein 28; binding protein-25; binding protein-26; binding protein-28; growth hormone independent-binding protein; hIGFBP 1; hIGFBP1; hIGFBP-1; IBP 1; IBP1; IBP-1; IGF BP25; IGFBA; IGF-binding protein 1; IGFBP; IGFBP 1; Igfbp1; Igfbp-1; IGF-BP25; Insulin like growth factor binding protein; insulin like growth factor binding protein 1; insulin-like growth factor binding protein 1; INSULIN-LIKE GROWTH FACTOR BINDING PROTEIN 1 PRECURSOR (IGFBP-1) (IBP-1) (IGF-BINDING PROTEIN 1); insulin-like growth factor-binding protein 1; Placental protein 12; PP 12; PP12 | |
IGFBP1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human IGFBP-1 (aa 91-161) Control Fragment | |
RUO | |
IGFBP-1 | |
Unconjugated | |
Recombinant | |
QQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGS | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.