missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ITK Partial ORF (NP_005537, 1 a.a. - 111 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003702-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16180315

  • 3343.96 SEK / 10µg

Estimated Shipment: 10-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes an intracellular tyrosine kinase expressed in T-cells. The protein contains both SH2 and SH3 domains which are often found in intracellular kinases. It is thought to play a role in T-cell proliferation and differentiation. [provided by RefSeq]

Sequence: MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETR
Specifications

Specifications

NP_005537
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.95kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETR
RUO
ITK
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3702
ITK (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EMT/LYK/MGC126257/MGC126258/PSCTK2
ITK
Yes
Videos
SDS
Documents
Certificates