missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human JARID1A Partial ORF (NP_005047, 191 a.a. - 290 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

3860.70 SEK - 5854.80 SEK

Specifications

Name JARID1A (Human) Recombinant Protein (Q01)
Recombinant Yes
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molecular Weight 36.74kDa
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16184155
View Documents Promotion Details
Abnova™
H00005927-Q01.10UG
10 ug
3860.70 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 16-03-2022
Please to purchase this item. Need a web account? Register with us today!
16194155
View Documents Promotion Details
Abnova™
H00005927-Q01.25UG
25 ug
5854.80 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 16-03-2022
Please to purchase this item. Need a web account? Register with us today!
Description

Description

The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein which regulates cell proliferation. This protein also interacts with rhombotin-2 which functions distinctly in erythropoiesis and in T-cell leukemogenesis. Rhombotin-2 is thought to either directly affect the activity of the encoded protein or may indirectly modulate the functions of the retinoblastoma protein by binding to this protein. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Sequence: KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF
Specifications

Specifications

JARID1A (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.74kDa
SDS
Product Certifications