missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human Kir2Ds5 Full-Length Orf (Aai60061.1, 1 A.A.-304 A.A.) Recombinant Protein With Gst Tag At N-Terminal. Product Code.: 16137141
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human Kir2Ds5 Full-Length Orf (Aai60061.1, 1 A.A.-304 A.A.) Recombinant Protein With Gst Tag At N-Terminal.

Abnova™ Human Kir2Ds5 Full-Length Orf (Aai60061.1, 1 A.A.-304 A.A.) Recombinant Protein With Gst Tag At N-Terminal.

Product Code. 16137141
25 μg, 25µg
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16137141

Brand: Abnova™ H00003810P01.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.

  • Good Folding
  • Excellent amino acids labeling

Immunogen Sequence: MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVT

Specifications

Accession Number AAI60061.1
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 3810
Name KIR2DS5 (Human) Recombinant Protein (P01)
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue
Quantity 25 μg
Immunogen MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNRTFQADFPLDPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNSSNSWPSPTEPSSETGNPRHLHVLIGTSVVKLPFTILLFFLLHRWCSNKKNASVMDQGPAGNRTVNREDSDEQDHQEVSYA
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias CD158G/NKAT9
Common Name KIR2DS5
Gene Symbol KIR2DS5
Protein Tag GST
Form Liquid
Show More Show Less

For Research Use Only

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human Kir2Ds5 Full-Length Orf (Aai60061.1, 1 A.A.-304 A.A.) Recombinant Protein With Gst Tag At N-Terminal. >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.