missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human Kir2Ds5 Full-Length Orf (Aai60061.1, 1 A.A.-304 A.A.) Recombinant Protein With Gst Tag At N-Terminal.

Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.

Brand:  Abnova™ H00003810-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137141

  • 5030.41 SEK / 25µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Good Folding
  • Excellent amino acids labeling

Immunogen Sequence: MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVT

Specifications

Specifications

AAI60061.1
Liquid
3810
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD158G/NKAT9
KIR2DS5
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
KIR2DS5 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue
MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNRTFQADFPLDPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNSSNSWPSPTEPSSETGNPRHLHVLIGTSVVKLPFTILLFFLLHRWCSNKKNASVMDQGPAGNRTVNREDSDEQDHQEVSYA
RUO
KIR2DS5
GST
Videos
SDS
Documents
Certificates

For Research Use Only