missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human LGALS9 Partial ORF (NP_033665, 254 a.a. - 355 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16117391

Abnova™ Human LGALS9 Partial ORF (NP_033665, 254 a.a. - 355 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16117391
25 ug, 25µg
Click to view available options
Quantity:
10 ug
25 ug
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16117391

Brand: Abnova™ H00003965Q01.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Used for AP, Array, ELISA, WB-Re

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq]

Sequence: FHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Specifications

Accession Number NP_033665
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 3965
Molecular Weight (g/mol) 36.96kDa
Name LGALS9 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 ug
Immunogen FHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias HUAT/LGALS9A/MGC117375/MGC125973/MGC125974
Common Name LGALS9
Gene Symbol LGALS9
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human LGALS9 Partial ORF (NP_033665, 254 a.a. - 355 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.