missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MACF1 Partial ORF (AAH07330, 1 a.a. - 95 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00023499-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16117382

  • 4055.00 SEK / 10µg
Estimated Shipment: 12-07-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene belongs to the plakin family of cytoskeletal linker proteins. This protein family forms bridges between different cytoskeletal elements through specialized modular domains. The encoded protein is one of the largest size proteins identified in human cytoskeletal proteins. It has functional actin and microtubule binding domains, and it appears to stabilize actin at sites where microtubules and microfilaments meet. It may function in microtubule dynamics to facilitate actin-microtubule interactions at the cell periphery and to couple the microtubule network to cellular junctions. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]

Sequence: KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF
Specifications

Specifications

AAH07330
Liquid
23499
MACF1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ABP620/ACF7/FLJ45612/FLJ46776/KIAA0465/KIAA1251/MACF/OFC4
MACF1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.08kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF
RUO
MACF1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers