missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MAP2K4 Partial ORF (AAH36032, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006416-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16135115

  • 3343.96 SEK / 10µg

Estimated Shipment: 07-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a dual specificity protein kinase that belongs to the Ser/Thr protein kinase family. This kinase is a direct activator of MAP kinases in response to various environmental stresses or mitogenic stimuli. It has been shown to activate MAPK8/JNK1, MAPK9/JNK2, and MAPK14/p38, but not MAPK1/ERK2 or MAPK3/ERK3. This kinase is phosphorylated, and thus activated by MAP3K1/MEKK. The knockout studies in mice suggested the roles of this kinase in mediating survival signal in T cell development, as well as in the organogenesis of liver. [provided by RefSeq]

Sequence: MAAPSPSGGGGSGGGRGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAE
Specifications

Specifications

AAH36032
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MAAPSPSGGGGSGGGRGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAE
RUO
MAP2K4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6416
MAP2K4 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
JNKK/JNKK1/MAPKK4/MEK4/MKK4/PRKMK4/SEK1/SERK1
MAP2K4
Yes
Videos
SDS
Documents
Certificates