Learn More
Abnova™ Human MAP3K7 Partial ORF (AAH17715.1, 471 a.a. - 579 a.a.) Recombinant Protein with GST-tag at N-terminal
Description
The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcription regulation and apoptosis. In response to IL-1, this protein forms a kinase complex including TRAF6, MAP3K7P1/TAB1 and MAP3K7P2/TAB2; this complex is required for the activation of nuclear factor kappa B. This kinase can also activate MAPK8/JNK, MAP2K4/MKK4, and thus plays a role in the cell response to environmental stresses. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]
Specifications
Specifications
| Accession Number | AAH17715.1 |
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 6885 |
| Molecular Weight (g/mol) | 37.73kDa |
| Name | MAP3K7 (Human) Recombinant Protein (Q01) |
| Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quantity | 25 ug |
| Immunogen | MAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS |
| Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Show More |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.