Learn More
Abnova™ Human MATK Partial ORF (AAH03109, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal
Description
The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq]
Specifications
Specifications
Accession Number | AAH03109 |
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 4145 |
Molecular Weight (g/mol) | 36.63kDa |
Name | MATK (Human) Recombinant Protein (Q01) |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quantity | 10 ug |
Immunogen | MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHTRPKPGELAFRKGDVVTILEACENKSWYRVKHHTSGQEGLL |
Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Show More |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.