missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MLKL Partial ORF (NP_689862, 371 a.a. - 471 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00197259-Q01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16132367

Estimated Shipment: 02-12-2021

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: VKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK

Specifications

Accession Number	NP_689862
For Use With (Application)	Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight	36.85kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	VKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK
Regulatory Status	RUO
Common Name	MLKL
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Expression System	wheat germ expression system
Format	Liquid
Gene ID (Entrez)	197259
Name	MLKL (Human) Recombinant Protein (Q01)
Quantity	25 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	FLJ34389
Gene Symbol	MLKL
Recombinant	Yes

Description