missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human MUC1 Control Fragment Recombinant Protein

Produktkod. 30210312
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30210312

Brand: Invitrogen™ RP102279

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MUC1 (Mucin 1, Episialin, MAM-6, CA 15-3, PEM and EMA) is a large cell surface mucin glycoprotein expressed by most glandular and ductal epithelial cells and some hematopoietic cell lineages. MUC1 is a transmembrane glycoprotein with a large mucin-like extracellular domain that matures through several intermediate forms generated by proteolysis, and sequential addition and processing of numerous O-linked glycans that are heavily sialylated. MUC1 is highly polymorphic and each allele encodes a product that contains a different number of repeats (between 30 and 90) leading to large differences in molecular weight of the protein. MUC1 is expressed on most secretory epithelium, including mammary gland and some hematopoietic cells, and is expressed abundantly in >90% breast carcinomas and metastases. Transgenic MUC1 has been shown to associate with all four cebB receptors and localize with erbB1 (EGFR) in lactating glands. The MUC1 gene contains seven exons and produces several different alternatively spliced variants. Overexpression, aberrant intracellular localization, and changes in glycosylation of the MUC1 protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of the MUC1 gene have been reported, but the full-length nature of only some has been determined. Transgenic MUC-1 has been shown to associate with all four cebB receptors and localize with erbB1 (EGFR) in lactating glands.
TRUSTED_SUSTAINABILITY

Specifications

Tillträdesnummer P15941
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 4582
Namn Human MUC1 Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias ADMCKD; ADMCKD1; Breast carcinoma-associated antigen DF3; CA 15-3; Cancer antigen 15-3; carcinoma-associated mucin; CD227; DF3 antigen; EMA; Episialin; H23 antigen; H23AG; J19; KL-6; Krebs von den Lungen-6; MAM6; MCD; MCKD; MCKD1; Medullary cystic kidney disease, autosomal dominant; Muc1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; MUC1-alpha; MUC1-beta; MUC1-CT; MUC1-NT; mucin 1, cell surface associated; mucin 1, transmembrane; Mucin1; mucin-1; Mucin-1 subunit alpha; Mucin-1 subunit beta; peanut-reactive urinary mucin; PEM; PEMT; Polymorphic epithelial mucin; PUM; tumor associated epithelial mucin; tumor-associated epithelial membrane antigen; Tumor-associated mucin
Vanligt namn MUC1
Gensymbol MUC1
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens ASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHGVTS
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.