missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MUCDHL Partial ORF (NP_068743, 27 a.a. - 125 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00053841-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16117436

  • 3860.70 SEK / 10µg
Estimated Shipment: 27-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is a novel mucin-like gene that is a member of the cadherin superfamily. While encoding nonpolymorphic tandem repeats rich in proline, serine and threonine similar to mucin proteins, the gene also contains sequence encoding calcium-binding motifs found in all cadherins. The role of the hybrid extracellular region and the specific function of this protein have not yet been determined. Alternative splicing has been identified, with observed variation resulting in the presence or absence of domains. In addition, splicing occurs in the 5' UTR but transcripts including these variations have not been described completely. [provided by RefSeq]

Sequence: AQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGALSTPFAFRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDNAPEFP
Specifications

Specifications

NP_068743
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGALSTPFAFRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDNAPEFP
RUO
MUPCDH
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
53841
MUCDHL (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ20219/MU-PCDH/MUCDHL
MUPCDH
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers