missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MYL5 Full-length ORF (AAH40050.1, 1 a.a. - 132 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004636-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138091

  • 5030.41 SEK / 25µg

Estimated Shipment: 14-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. [provided by RefSeq]

Sequence: MDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Specifications

Specifications

AAH40050.1
AP, Array, ELISA, WB-Re
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
40.26kDa
Glutathione Sepharose 4 Fast Flow
25μg
RUO
MYL5
Yes
wheat germ expression system
Liquid
4636
Human MYL5 Full-length ORF (AAH40050.1, 1 a.a. - 132 a.a.) Recombinant Protein with GST-tag at N-terminal
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at −80°C. Aliquot to avoid repeated freezing and thawing.
MYL5
Wheat Germ (in vitro)
GST Tag
Videos
SDS
Documents
Certificates