missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human MYL5 Full-length ORF (AAH40050.1, 1 a.a. - 132 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16138091

Abnova™ Human MYL5 Full-length ORF (AAH40050.1, 1 a.a. - 132 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16138091
25μg, 25µg
Click to view available options
Quantity:
10 ug
25μg
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16138091

Brand: Abnova™ H00004636P01.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Used for AP, Array, ELISA, WB-Re

This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. [provided by RefSeq]

Sequence: MDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE

Specifications

Accession Number AAH40050.1
For Use With (Application) Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 4636
Molecular Weight (g/mol) 40.26kDa
Name Human MYL5 Full-length ORF (AAH40050.1, 1 a.a. - 132 a.a.) Recombinant Protein with GST-tag at N-terminal
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25μg
Storage Requirements Store at −80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Common Name MYL5
Gene Symbol MYL5
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST Tag
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human MYL5 Full-length ORF (AAH40050.1, 1 a.a. - 132 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.