missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MYO1F Partial ORF (NP_036467.2, 811 a.a. - 912 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00004542-Q01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16131455

Estimated Shipment: 09-12-2021

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: KKKVDIQALRGVSLSTRQDDFFILQEDAADSFLESVFKTEFVSLLCKRFEEATRRPLPLTFSDTLQFRVKKEGWGGGGTRSVTFSRGFGDLAVLKVGGRTLT

Specifications

Accession Number	NP_036467.2
For Use With (Application)	Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight	36.96kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	KKKVDIQALRGVSLSTRQDDFFILQEDAADSFLESVFKTEFVSLLCKRFEEATRRPLPLTFSDTLQFRVKKEGWGGGGTRSVTFSRGFGDLAVLKVGGRTLT
Regulatory Status	RUO
Gene Symbol	MYO1F
Recombinant	Yes

Expression System	wheat germ expression system
Format	Liquid
Gene ID (Entrez)	4542
Name	MYO1F (Human) Recombinant Protein (Q01)
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	MYO1F
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Description