Learn More
Abnova™ Human N4BP2 Partial ORF (NP_060647, 1671 a.a. - 1770 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
3970.00 SEK - 6025.00 SEK
Specifications
| Accession Number | NP_060647 |
|---|---|
| For Use With (Application) | Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) |
| Format | Liquid |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 55728 |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16138316
|
Abnova™
H00055728-Q01.10UG |
10 ug |
3970.00 SEK
10µg |
Estimated Shipment: 05-01-2023 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! |
16148316
|
Abnova™
H00055728-Q01.25UG |
25 ug |
6025.00 SEK
25µg |
Estimated Shipment: 05-01-2023 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! |
Description
This gene encodes a protein containing a polynucleotide kinase domain (PNK) near the N-terminal region, and a Small MutS Related (Smr) domain near the C-terminal region. The encoded protein can bind to both B-cell leukemia/lymphoma 3 (BCL-3) and neural precursor cell expressed, developmentally downregulated 4, (Nedd4) proteins. This protein binds and hydrolyzes ATP, may function as a 5'-polynucleotide kinase, and has the capacity to be a ubiquitylation substrate. This protein may play a role in transcription-coupled DNA repair or genetic recombination. [provided by RefSeq]
Sequence: HLAAIEIFEKVNASLLPQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLKSpecifications
| NP_060647 | |
| Liquid | |
| 55728 | |
| N4BP2 (Human) Recombinant Protein (Q01) | |
| HLAAIEIFEKVNASLLPQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK | |
| RUO | |
| N4BP2 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| B3BP/FLJ10680/KIAA1413 | |
| N4BP2 | |
| Yes | |
| wheat germ expression system |