missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human N4BP2 Partial ORF (NP_060647, 1671 a.a. - 1770 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

3970.00 SEK - 6025.00 SEK

Specifications

Accession Number NP_060647
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Format Liquid
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 55728
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16138316
View Documents Promotion Details
Abnova™
H00055728-Q01.10UG
10 ug
3970.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 05-01-2023
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16148316
View Documents Promotion Details
Abnova™
H00055728-Q01.25UG
25 ug
6025.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 05-01-2023
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

This gene encodes a protein containing a polynucleotide kinase domain (PNK) near the N-terminal region, and a Small MutS Related (Smr) domain near the C-terminal region. The encoded protein can bind to both B-cell leukemia/lymphoma 3 (BCL-3) and neural precursor cell expressed, developmentally downregulated 4, (Nedd4) proteins. This protein binds and hydrolyzes ATP, may function as a 5'-polynucleotide kinase, and has the capacity to be a ubiquitylation substrate. This protein may play a role in transcription-coupled DNA repair or genetic recombination. [provided by RefSeq]

Sequence: HLAAIEIFEKVNASLLPQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK
Specifications

Specifications

NP_060647
Liquid
55728
N4BP2 (Human) Recombinant Protein (Q01)
HLAAIEIFEKVNASLLPQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK
RUO
N4BP2
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
B3BP/FLJ10680/KIAA1413
N4BP2
Yes
wheat germ expression system
SDS
Product Certifications