Learn More
Abnova™ Human NAP1L4 Partial ORF (NP_005960, 1 a.a. - 82 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00004676-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a member of the nucleosome assembly protein (NAP) family which can interact with both core and linker histones. It can shuttle between the cytoplasm and nucleus, suggesting a role as a histone chaperone. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. [provided by RefSeq]
Sequence: MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINALKQLQVRCAHIEASpecifications
| NP_005960 | |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.76kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINALKQLQVRCAHIEA | |
| RUO | |
| NAP1L4 | |
| Wheat Germ (in vitro) | |
| GST |
| wheat germ expression system | |
| Liquid | |
| 4676 | |
| NAP1L4 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC4565/NAP2/NAP2L/hNAP2 | |
| NAP1L4 | |
| Yes |