missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human NBN Partial ORF (NP_002476, 645 a.a. - 754 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4630.00 SEK - 7020.00 SEK
Specifications
| Accession Number | NP_002476 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 4683 |
| Molecular Weight (g/mol) | 37.84kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16188161
|
Abnova™
H00004683-Q01.25ug |
25 ug |
7020.00 SEK
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
16178161
|
Abnova™
H00004683-Q01.10ug |
10 ug |
4630.00 SEK
10µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Mutations in this gene are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation. [provided by RefSeq]
Sequence: DDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRRSpecifications
| NP_002476 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.84kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| AT-V1/AT-V2/ATV/FLJ10155/MGC87362/NBS/NBS1/P95 | |
| NBN | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 4683 | |
| NBN (Human) Recombinant Protein (Q01) | |
| DDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR | |
| RUO | |
| NBN | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ Human NBN Partial ORF (NP_002476, 645 a.a. - 754 a.a.) Recombinant Protein with GST-tag at N-terminal