Learn More
Abnova™ Human NDUFA1 Full-length ORF (AAH00266, 1 a.a. - 70 a.a.) Recombinant Protein with GST-tag at N-terminal
Description
The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the hydrophobic protein (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. [provided by RefSeq]
Specifications
Specifications
Accession Number | AAH00266 |
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 4694 |
Molecular Weight (g/mol) | 33.44kDa |
Name | NDUFA1 (Human) Recombinant Protein (P02) |
Purification Method | Glutathione Sepharose 4 Fast Flow |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quantity | 10 ug |
Immunogen | MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID |
Show More |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.