Learn More
Abnova™ Human NDUFA8 Partial ORF (NP_055037.1, 1 a.a. - 72 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4630.00 SEK - 7020.00 SEK
Specifications
Accession Number | NP_055037.1 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 4702 |
Molecular Weight (g/mol) | 33.66kDa |
Description
The protein encoded by this gene belongs to the complex I 19 kDA subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq]
Sequence: MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRSpecifications
NP_055037.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.66kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CI-19KD/CI-PGIV/MGC793/PGIV | |
NDUFA8 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
4702 | |
NDUFA8 (Human) Recombinant Protein (Q01) | |
MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR | |
RUO | |
NDUFA8 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.